DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and ea

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:296 Identity:103/296 - (34%)
Similarity:139/296 - (46%) Gaps:52/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 PAAQNQTSPTCSCRCGERND--ESRIVGGTTTGVSEYPWMARLSYFNR-----FYCGGTLINDRY 162
            |...|.||.:.....|:..:  .:||.||..|.:.|:||||.:.|...     .:|||:||:.||
  Fly   103 PPKPNVTSNSLLPLPGQCGNILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRY 167

  Fly   163 VLTAAHCVKGFM----WFMIKVTFGEHDR-----CN------------------DKERPETRFVL 200
            |:||:|||.|..    |.:..|..||.|.     |.                  ::..|...::.
  Fly   168 VITASHCVNGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIP 232

  Fly   201 RAFSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLP-RVEQRQDLFVGTKAIATGWGTLKEDGK 264
            .:.:|.       ||||||||..:|..|.|:|||||| .|..|...|.|......|||. .|...
  Fly   233 ASKNQV-------NDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGK-TEQLS 289

  Fly   265 PSCLLQEVEVPVLDNDECVAQTNYTQK--MITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPD-- 325
            .|.|..:..|.....|||  |..|:.:  ::....||:|  |..|.|||:|||||||:.|..:  
  Fly   290 ASNLKLKAAVEGFRMDEC--QNVYSSQDILLEDTQMCAG--GKEGVDSCRGDSGGPLIGLDTNKV 350

  Fly   326 DKRFEQIGIVSWG-NGCARPNYPGVYTRVTKYLDWI 360
            :..:...|:||:| ..|....:|||||.|.||:|||
  Fly   351 NTYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWI 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 96/270 (36%)
Tryp_SPc 128..363 CDD:238113 97/271 (36%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 96/270 (36%)
Tryp_SPc 128..389 CDD:238113 97/271 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.