DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG3916

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:260 Identity:74/260 - (28%)
Similarity:116/260 - (44%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SRIVGGTTTGVSE-YPWMARLSYFNR----FYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFG-- 183
            :||.||..  |:| .|:...|....|    .:|||::::.::|||||||::......:.|..|  
  Fly    29 TRINGGQR--VNETVPFQVSLQMQRRGRWQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVGTL 91

  Fly   184 -------EHDRCNDKERPETRFVLRAFSQKFSFS-NFDNDIALLRLNDRVPITSFIRPICLPRVE 240
                   .|           |.|.:....::|.: ...|||||:::..         |..|.|.:
  Fly    92 NWKAGGLRH-----------RLVTKHVHPQYSMNPRIINDIALVKVTP---------PFRLERSD 136

  Fly   241 QRQDLFVGTKAIA-------TGWGTLKEDGKPSCL---LQEVEVPVLDNDECVAQTNYTQKMITK 295
            ....|..|:..|.       ||||:.......:.|   ||.:....:.|::|    |.....:|:
  Fly   137 ISTILIGGSDRIGEKVPVRLTGWGSTSPSTSSATLPDQLQALNYRTISNEDC----NQKGFRVTR 197

  Fly   296 NMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
            |.:|:  ..|.|:.:|.|||||||:|   ..|:...:||||:|:.......|.|||||:.:|.:|
  Fly   198 NEICA--LAVQGQGACVGDSGGPLIR---PGKQPHLVGIVSYGSSTCAQGRPDVYTRVSSFLPYI 257

  Fly   361  360
              Fly   258  257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 73/257 (28%)
Tryp_SPc 128..363 CDD:238113 73/258 (28%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 73/257 (28%)
Tryp_SPc 31..260 CDD:238113 73/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.