DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Sp7

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:359 Identity:122/359 - (33%)
Similarity:168/359 - (46%) Gaps:92/359 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ATS-APPATSTATSSLSSIPGKYQALGAAHHQAKKLKIGDVNASSSDANKPVFRQNPIKNWFGAF 99
            ||| |||.|:|::||...                     |..|                   |..
  Fly    95 ATSAAPPPTTTSSSSRGQ---------------------DGQA-------------------GLG 119

  Fly   100 NRNNSPAAQNQTSPTCSCRCGERNDESRIVGGTTTGVSEYPWMARLSYF-NR----FYCGGTLIN 159
            |...||.           :||..:..:::..|..|.:.|:.|||.|.|. ||    ..|||:|||
  Fly   120 NLLPSPP-----------KCGPHSFSNKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLIN 173

  Fly   160 DRYVLTAAHCVKGF----MWFMIKVTFGEHDRCNDKE-------RPETRFVLR-AFSQKFSFSNF 212
            :||||||||||.|.    :..:..|..||:|...|.:       :|    :|: ...|......:
  Fly   174 NRYVLTAAHCVIGAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQP----ILQLGIEQATVHPQY 234

  Fly   213 D-------NDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQ 270
            |       :|||||||:..|.:..:|:|:|||.|..|..:..|...:.:|||. ....:.|.:.|
  Fly   235 DPANKNRIHDIALLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGR-TTTARKSTIKQ 298

  Fly   271 EVEVPVLDNDECVAQTNYTQKMITKNM-MCSGYPGVGG---RDSCQGDSGGPLVRLRPDDKRFEQ 331
            .:::||.|:|.|      .:|..|:|: :.|....|||   ||||.|||||||:| |..|:.:.|
  Fly   299 RLDLPVNDHDYC------ARKFATRNIHLISSQLCVGGEFYRDSCDGDSGGPLMR-RGFDQAWYQ 356

  Fly   332 IGIVSWGNGCARPNYPGVYTRVTKYLDWIVENSR 365
            .|:||:||.|....:|||||||..|:|||||..|
  Fly   357 EGVVSFGNRCGLEGWPGVYTRVADYMDWIVETIR 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 99/260 (38%)
Tryp_SPc 128..363 CDD:238113 102/262 (39%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 99/260 (38%)
Tryp_SPc 137..388 CDD:238113 102/262 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.