DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:264 Identity:102/264 - (38%)
Similarity:145/264 - (54%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERN---DESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFM------ 174
            ||.|.   ...::.||......|:||.|.|...|...||.|||::.:::|||||   |:      
  Rat   175 CGRRTITPGGHKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHC---FVRSANPK 236

  Fly   175 -WFMIKVTFGEHDRCNDKERPETRFVLRA--FSQKFSFSNFDNDIALLRLNDRVPITSFIRPICL 236
             |   ||:||..     ..:|:.:..:::  ..:.:|:...:||||::||:..|...:.||..||
  Rat   237 DW---KVSFGFL-----LSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACL 293

  Fly   237 PRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSG 301
            |  |..|.....:..:.|||||||.||....:||:..|.::||..|.:...| ..:||..|:|:|
  Rat   294 P--EATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAY-GGVITPGMLCAG 355

  Fly   302 YPGVGGR-DSCQGDSGGPLVRLRPDDKR--FEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVEN 363
            :  :.|| |:||||||||||   .:|.:  :...||||||:.||.||.||||||||.|.|||  :
  Rat   356 F--LEGRVDACQGDSGGPLV---SEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI--S 413

  Fly   364 SRDG 367
            |:.|
  Rat   414 SKTG 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 95/244 (39%)
Tryp_SPc 128..363 CDD:238113 97/246 (39%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 95/244 (39%)
Tryp_SPc 187..415 CDD:238113 97/248 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.