DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG9372

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:251 Identity:100/251 - (39%)
Similarity:144/251 - (57%) Gaps:13/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERNDE-SRIVGGTTTGVSEYPWMARL--SYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKV 180
            ||..:.: .|:.||......|:||||.|  ......:|||.||.||:|||||||:.......|.|
  Fly   164 CGITSRQFPRLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFV 228

  Fly   181 TFGEHD--RCNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQ 243
            ..||::  ..|:....:.|.........::..|:|||||::|::......::|.|:|:|.|.:. 
  Fly   229 RLGEYNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVNED- 292

  Fly   244 DLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGR 308
              :....||.|||||.|..|..|.:|.||.:||....:|  ::::.|. :....||:|:| .||:
  Fly   293 --WSDRNAIVTGWGTQKFGGPHSNILMEVNLPVWKQSDC--RSSFVQH-VPDTAMCAGFP-EGGQ 351

  Fly   309 DSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENS 364
            |||||||||||:...| ::|:..|||||||.||.:...||:||||.:|||||:.|:
  Fly   352 DSCQGDSGGPLLVQLP-NQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWILANA 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 95/236 (40%)
Tryp_SPc 128..363 CDD:238113 96/238 (40%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 95/236 (40%)
Tryp_SPc 176..402 CDD:238113 94/233 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
54.960

Return to query results.
Submit another query.