DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and proca

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_956650.1 Gene:proca / 393327 ZFINID:ZDB-GENE-060824-5 Length:434 Species:Danio rerio


Alignment Length:291 Identity:99/291 - (34%)
Similarity:153/291 - (52%) Gaps:46/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TCSC-----------RCGERNDES---------------------RIVGGTTTGVSEYPWMAR-L 145
            ||||           :|..:||.|                     .::||......|.||.|. |
Zfish   149 TCSCIKGYQLQDNSRKCTPKNDASCGQIRIPKSAYANKPKPVLQPWVMGGNVGKRGESPWQALIL 213

  Fly   146 SYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCNDKERPETRFVLRAFSQ-KFSF 209
            ::..||:|||.||::.:|||||||::....|.:::  |::.|...:....|..|.:..|. :::.
Zfish   214 NHLGRFHCGGVLIDENWVLTAAHCLETSSKFSVRL--GDYQRFKFEGSEVTLPVKQHISHPQYNP 276

  Fly   210 SNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLF--VGTKAIATGWGTLKEDGKP-SCLLQE 271
            ...|||||||||:..|..:::|.|.|||.:|..:.:.  .||..|.||||...:.... :..|..
Zfish   277 ITVDNDIALLRLDGPVKFSTYILPACLPSLELAKRMLHRNGTVTIITGWGKNNQSATSYNSTLHY 341

  Fly   272 VEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVS 336
            ||:|::||.||   :.:....::.||:|:|..| ..:|:|:||||||::.|..|  .:..:|:||
Zfish   342 VELPIVDNKEC---SRHMMNNLSDNMLCAGVLG-QVKDACEGDSGGPMMTLFHD--TWFLVGLVS 400

  Fly   337 WGNGCARPNYPGVYTRVTKYLDWIVENSRDG 367
            ||.||.:.:..|:||:|..||||| ::.|.|
Zfish   401 WGEGCGQRDKLGIYTKVASYLDWI-DSVRQG 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 87/237 (37%)
Tryp_SPc 128..363 CDD:238113 89/239 (37%)
procaNP_956650.1 GLA 23..84 CDD:214503
EGF_CA 85..119 CDD:238011
FXa_inhibition 128..165 CDD:291342 4/15 (27%)
Tryp_SPc 195..427 CDD:238113 89/240 (37%)
Tryp_SPc 197..424 CDD:214473 87/234 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.