DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG4477

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:220 Identity:50/220 - (22%)
Similarity:89/220 - (40%) Gaps:24/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 YCGGTLINDRYVLTAAHCVKGFMWFMIK-----VTFGEHDRCNDKERPETRFVLRA----FSQKF 207
            :|.|.::...:|:|:|||:......:|.     :..|..:|.  |..|...||...    ....|
  Fly    71 FCSGVILAPMFVMTSAHCLINKRRVLISSRVLLIVAGTLNRL--KYIPNRTFVTPVTHIWLPDSF 133

  Fly   208 SFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEV 272
            :..| ..|..||::.:..|..:  ..|.:.|:.....| .|.|....|||.:.:.|..:..:..:
  Fly   134 TMRN-KQDFGLLKVKNPFPRNN--EHISIARLPVHPPL-PGLKCKVMGWGRMYKGGPLASYMLYI 194

  Fly   273 EVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSW 337
            :|.|:|::.|   ..:.:....:::.......:..:..|.||.|.|::.      .....|||:.
  Fly   195 DVQVIDSEAC---AKWLRVPSVEHVCAVDSDDLTAQQPCGGDWGAPMLH------NGTVYGIVTI 250

  Fly   338 GNGCARPNYPGVYTRVTKYLDWIVE 362
            ..||...:.|.:||.|....:||.|
  Fly   251 LAGCGVSHLPSLYTNVHSNANWIHE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 47/216 (22%)
Tryp_SPc 128..363 CDD:238113 50/220 (23%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 50/220 (23%)
Tryp_SPc 55..273 CDD:214473 47/216 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.