DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG32374

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:307 Identity:86/307 - (28%)
Similarity:120/307 - (39%) Gaps:77/307 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KNWFGAFNRNNS-------PAAQNQT------SPTCSCRCGERND--ESRIVGGTTTGVSEYPWM 142
            |||.|.:..|.:       |..:.||      |...:....|..|  .:|||.|.....|..|:.
  Fly    24 KNWSGYYVDNGTHYLLYEGPRIKPQTFLPGNISTNPAINALEAQDYLPTRIVNGKKIKCSRAPYQ 88

  Fly   143 ARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCNDKERPETRFVLRAFS--- 204
            ..|.|.|.|.||..::|.|::|||.||..|                    .| .|:.:||.|   
  Fly    89 CALHYNNYFICGCVILNRRWILTAQHCKIG--------------------NP-GRYTVRAGSTQQ 132

  Fly   205 ---------QK------FSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKA--- 251
                     ||      :|.....||:.:::|...:.:...::.:.||...        ||.   
  Fly   133 RRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKLPSTR--------TKRFPK 189

  Fly   252 --IATGWGTLKEDGK-PSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQG 313
              :|:|||....:.: ....|:.|.|..:...:|......|...|.|.|:|:...   .||:|.|
  Fly   190 CYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRK---NRDTCSG 251

  Fly   314 DSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
            |||||||.      .....||.|:|.|||...|||||..|.:|..||
  Fly   252 DSGGPLVH------NGVLYGITSFGIGCASAKYPGVYVNVLQYTRWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 73/256 (29%)
Tryp_SPc 128..363 CDD:238113 74/257 (29%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 73/256 (29%)
Tryp_SPc 74..295 CDD:238113 74/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.