DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and KLKB1

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:408 Identity:128/408 - (31%)
Similarity:183/408 - (44%) Gaps:73/408 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WPLVLAMASCLLFTAATSATPATPATPATSAPPATSTATSSL----SSIPGK-----YQALGAAH 64
            |.:......|||.|:.:       .||::|.|...:.:..||    .::|..     |..:....
Human   258 WKIESQRNVCLLKTSES-------GTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGG 315

  Fly    65 HQAKKLKIGDVNASSSDANKPV-------------FRQNPIKNWFGAFNRNNSP---AAQNQTSP 113
            .:.....:..||.......|.:             .::...| .|...:.:.||   |...|.|.
Human   316 EELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCK-CFLRLSMDGSPTRIAYGTQGSS 379

  Fly   114 TCSCRCGERNDES--------RIVGGTTTGVSEYPWMARLSY---FNRFYCGGTLINDRYVLTAA 167
            ..|.|.....|.|        ||||||.:...|:||...|..   ..|..|||:||..::|||||
Human   380 GYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAA 444

  Fly   168 HCVKGF----MWFMIKVTFGEHDRCNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPIT 228
            ||..|.    :|.:........|...|....:.:.::  ..|.:..|..::||||::|...:..|
Human   445 HCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEII--IHQNYKVSEGNHDIALIKLQAPLNYT 507

  Fly   229 SFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMI 293
            .|.:|||||.......::  |....||||..||.|:...:||:|.:|::.|:||  |..|....|
Human   508 EFQKPICLPSKGDTSTIY--TNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEEC--QKRYQDYKI 568

  Fly   294 TKNMMCSGYPGVGGRDSCQGDSGGPLV-------RLRPDDKRFEQIGIVSWGNGCARPNYPGVYT 351
            |:.|:|:||. .||:|:|:||||||||       ||         :||.|||.||||...|||||
Human   569 TQRMVCAGYK-EGGKDACKGDSGGPLVCKHNGMWRL---------VGITSWGEGCARREQPGVYT 623

  Fly   352 RVTKYLDWIVE--NSRDG 367
            :|.:|:|||:|  .|.||
Human   624 KVAEYMDWILEKTQSSDG 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 95/246 (39%)
Tryp_SPc 128..363 CDD:238113 97/250 (39%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519 11/43 (26%)
APPLE 303..386 CDD:128519 13/83 (16%)
Tryp_SPc 401..632 CDD:214473 95/246 (39%)
Tryp_SPc 402..632 CDD:238113 94/245 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42230
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.