DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001004020.1 Gene:Tmprss11b / 365265 RGDID:1303278 Length:420 Species:Rattus norvegicus


Alignment Length:339 Identity:107/339 - (31%)
Similarity:156/339 - (46%) Gaps:89/339 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TSSLSSIPGKYQALGAAHHQAKKLKIGDVNASSSDANKPVFRQNPIKNWFGAFNRNNSPAAQNQT 111
            :.||::.||             .||:.::  :..||.|.:               ||        
  Rat   148 SGSLTTDPG-------------SLKLTEI--TKVDAEKII---------------NN-------- 174

  Fly   112 SPTCSCRCGERNDES----RIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKG 172
                  |||.|...|    ||.||:|....|:||.|.|....:.:||.:||.:|::||||||   
  Rat   175 ------RCGRRPRMSATYDRITGGSTAQKGEWPWQASLRVNGKHHCGASLIGERFLLTAAHC--- 230

  Fly   173 FMWFM-------IKVTFGEHDRCNDKERPETRFVLRAFSQ----------KFSFSNFDNDIALLR 220
               |:       :.|:||            || |..|:.|          .:......:|:|:::
  Rat   231 ---FLRTNNPKNLTVSFG------------TR-VTPAYMQHYVEEVIIHEDYVKGQHHDDVAIIK 279

  Fly   221 LNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQ 285
            |.::|...:.:..:|||  |..|....|...:.||||:|..:||...|||:..:.::|.:.|.::
  Rat   280 LTEKVSFRNDVHRVCLP--EATQVFPPGEGVVVTGWGSLSYNGKSPLLLQKASIKIIDTNACNSE 342

  Fly   286 TNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVY 350
            ..|..: |...|:|:||. .|..|:||||||||||.....|..: .:||||||:.|.|.|.||||
  Rat   343 EAYGGR-IMDTMLCAGYM-EGYVDACQGDSGGPLVHPNSRDIWY-LVGIVSWGHECGRVNKPGVY 404

  Fly   351 TRVTKYLDWIVENS 364
            .|||.|.|||...:
  Rat   405 MRVTSYRDWIASKT 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 89/249 (36%)
Tryp_SPc 128..363 CDD:238113 90/251 (36%)
Tmprss11bNP_001004020.1 SEA 50..144 CDD:279699
Tryp_SPc 188..414 CDD:214473 89/249 (36%)
Tryp_SPc 189..417 CDD:238113 90/251 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.