DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and PRSS41

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:281 Identity:100/281 - (35%)
Similarity:138/281 - (49%) Gaps:49/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 AQNQTSPTCSCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVK 171
            |::|.....|..||.|...:.:.||..:....:||.|.|....|..|||:|::.|:||:||||.:
Human    50 AESQEEELLSEACGHREIHALVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHCFQ 114

  Fly   172 GFM----WFMIKVTFGEHDRCNDKERPETRFVLRAFSQKFSFSN----------FDNDIALLRLN 222
            ...    |   .|..||.     ..|| |.:.|||:|.::...:          ..||||||||.
Human   115 KHYYPSEW---TVQLGEL-----TSRP-TPWNLRAYSSRYKVQDIIVNPDALGVLRNDIALLRLA 170

  Fly   223 DRVPITSFIRPICLP----RVEQRQDLFVGTKAIATGWGTLKEDG---KPSCLLQEVEVPVLDND 280
            ..|...::|:|||:.    ....|.|.:|      ||||.:...|   .|...|:|.:|.:|:|.
Human   171 SSVTYNAYIQPICIESSTFNFVHRPDCWV------TGWGLISPSGTPLPPPYNLREAQVTILNNT 229

  Fly   281 ECVAQTNY------TQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGN 339
            .|    ||      ::.||..:|.|:|... |..|:|:||||||||  ...|..:.|:||||||.
Human   230 RC----NYLFEQPSSRSMIWDSMFCAGAED-GSVDTCKGDSGGPLV--CDKDGLWYQVGIVSWGM 287

  Fly   340 GCARPNYPGVYTRVTKYLDWI 360
            .|.:||.|||||.::.|..||
Human   288 DCGQPNRPGVYTNISVYFHWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 92/259 (36%)
Tryp_SPc 128..363 CDD:238113 94/260 (36%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.