DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG13744

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:406 Identity:116/406 - (28%)
Similarity:168/406 - (41%) Gaps:80/406 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVLAMASCLLFTAATSATPATPATPATSAPPATSTATSSLSSIPGKYQALGAAHHQAK----KLK 71
            |:|.:..|||.....|:             |:.:...::|..:|.:      ..||:.    ||.
  Fly     3 LLLWLCLCLLLLICQSS-------------PSQANILNTLLGVPAE------CVHQSGVWPCKLS 48

  Fly    72 I-----GDVNASSSDANKPVFR-----------------QNPIKNW--FG--AFNRNNSPAA--- 107
            .     |..:|....:||.:|.                 .:|:.|.  :|  ..|.|:.|..   
  Fly    49 FSCWLQGGKHAKGCGSNKWLFSCCVAETQHPHQQQHHSPSSPLANLVDYGKLKLNLNSLPKRIML 113

  Fly   108 ----QNQ---TSPTCSC-RCGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVL 164
                .|:   ..|.|.. |..:...:.||:||.....:||||.|.:. ...:.|||.||:...|.
  Fly   114 RRRDDNELLNPKPECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIR-IAEYQCGGVLISANMVA 177

  Fly   165 TAAHCVKGFMWFMIKVTFGEHD-----RCNDKERPETRFVL-RAFSQKFSF--SNFDN-DIALLR 220
            |||||::......|.|..||.|     ..::....|...|| :....:|:|  :..|. |||||:
  Fly   178 TAAHCIQQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLK 242

  Fly   221 LNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWG-TLKEDGKPSC-LLQEVEVPVLDNDECV 283
            |......|..|.|||||:...|   .:|.|.:..||| |....|.... :||...||::...:|:
  Fly   243 LAQPTSFTEHILPICLPQYPIR---LIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCI 304

  Fly   284 A--QTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNY 346
            .  ::......|...|.|:|:.. |..|:|.||||||||  ..:..||..:||.|.|.||...:.
  Fly   305 RWHESKQINVEIKAEMFCAGHSD-GHMDACLGDSGGPLV--IKERGRFVLVGITSAGFGCGVDHQ 366

  Fly   347 PGVYTRVTKYLDWIVE 362
            ||:|..|.|.:.||.|
  Fly   367 PGIYHNVQKTVRWIQE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 85/245 (35%)
Tryp_SPc 128..363 CDD:238113 87/248 (35%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 85/245 (35%)
Tryp_SPc 142..383 CDD:238113 87/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.