DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and flz

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:378 Identity:133/378 - (35%)
Similarity:182/378 - (48%) Gaps:56/378 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TAATSATPATPAT---------------PATSAPP---ATSTATSSLSSI-PGKYQALGAAHHQA 67
            |:|.|.|...|||               |||..|.   :::..|:::||. |...:.:.....: 
  Fly  1326 TSAVSTTTRKPATRRTTVAAKVTTTTRRPATKKPTRRVSSTVKTTTVSSARPADDEIVDEEDEE- 1389

  Fly    68 KKLKIGDVNASSSDANKPVFRQNPIKNWFGAFNRNNSPAAQNQTSPTC-----SCRCGERN--DE 125
                  |||.:.||  ..:.:...:.::.||..|.....::...:|..     |..||.|.  ..
  Fly  1390 ------DVNPNPSD--NEIDQGATLSSYGGANGRKIHSTSRTLPTPNLAFHSPSTECGVRPHVKS 1446

  Fly   126 SRIVGGTTTGVSEYPWMAR------LSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGE 184
            .|||||..:....|||...      |..|.:..|||.||..|||:|||||..||:..::.| .||
  Fly  1447 GRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNKCGGVLITSRYVITAAHCQPGFLASLVAV-MGE 1510

  Fly   185 HDRCNDKE--RPETRFVLRAF-SQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDL- 245
            .|...|.|  |..|:.|.|.. .:::..:.|:||:|||.|:..|...:.|.|||:|     .|: 
  Fly  1511 FDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICMP-----NDVA 1570

  Fly   246 -FVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDEC--VAQTNYTQKMITKNMMCSGYPGVGG 307
             |.|..|..||||.||..|....:||||:||:::|..|  :..|....|.|..:.:|:||.. |.
  Fly  1571 DFTGRMATVTGWGRLKYGGGVPSVLQEVQVPIIENSVCQEMFHTAGHNKKILTSFLCAGYAN-GQ 1634

  Fly   308 RDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
            :|||:||||||||..|||. |:|..|.||.|..||.|..||||.|.|.|..|:
  Fly  1635 KDSCEGDSGGPLVLQRPDG-RYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 104/245 (42%)
Tryp_SPc 128..363 CDD:238113 104/246 (42%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 104/246 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.