DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG8738

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:270 Identity:90/270 - (33%)
Similarity:130/270 - (48%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERNDESRI--VGGTTTGVS---EYPWM-ARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFM 177
            ||..|.:...  :.|...|.|   |:||| |.:.....|.||||||:.:.|||:||.|.......
  Fly   188 CGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDS 252

  Fly   178 IKVTFGEHDRCNDKE-RPETRFVLRAFSQKFSFSNFD-----NDIALLRLNDRVPITSFIRPICL 236
            :.|..|:.|..:..| .|   :.:||.|:.....||:     |||||:.|.....:...|:||||
  Fly   253 LLVRAGDWDLNSQTELHP---YQMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICL 314

  Fly   237 PRVE--QRQDLFVGTKAIATGWG-------TLKEDGKPSCLLQEVEVPVLDNDECVAQTNYT--- 289
            |..|  |.:........:|||||       |::.      ||:.:|:|.:|::.|.....:|   
  Fly   315 PPPETPQMEAELRSASCLATGWGLRYSTSRTMEN------LLKRIELPAVDHESCQRLLRHTVLG 373

  Fly   290 -QKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDK-RFEQIGIVSWGNGCARPNYPGVYTR 352
             :..:..:..|:|  ||.|:|:|.||.|.||....|..| |::.:|:||||..||..:.|..||.
  Fly   374 RRYNLHPSFTCAG--GVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTN 436

  Fly   353 VTKYLDWIVE 362
            |....:||.|
  Fly   437 VAYLRNWIDE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 84/258 (33%)
Tryp_SPc 128..363 CDD:238113 87/261 (33%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 85/251 (34%)
Tryp_SPc 207..444 CDD:214473 82/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.