DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG8586

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:375 Identity:105/375 - (28%)
Similarity:162/375 - (43%) Gaps:55/375 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 TSATPATPATPATSA--PPATSTATSSLSSIPGKYQALGAAHHQAKKLKIGDVNASSSDANKPVF 87
            |:..|:|.....:|.  ||...:...::..:|            .|..:...:|.|......|  
  Fly    82 TTTVPSTIRNKVSSVLEPPPNESCGQNMECVP------------RKLCRDNIINDSGISLINP-- 132

  Fly    88 RQNPI---KNWFGA------FNRNNSPAAQNQTSPTCSCRCGERNDESRIVGGTTTGVS------ 137
            |.:||   |:.:..      .:.:.||....|.:.... .||..|.:..|........|      
  Fly   133 RISPIQCSKSLYRCCAVDQKVDDSESPYLVKQANFKYK-NCGYSNPKGLIPDNDKFPYSEDVSIF 196

  Fly   138 -EYPWMARLSYFNR--FYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCNDKERPETRFV 199
             |:|||..: :..|  |.||||||:.|.|:|.:|.:.......:....|:.| .|....|.....
  Fly   197 GEFPWMVGI-FTGRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWD-LNSLNEPYPHQG 259

  Fly   200 LRAFSQKFSFSNFD-----NDIALLRLNDRVPITSFIRPICLPRVEQRQ--DLFVGTKAIATGWG 257
            .| ..:....|.||     ||||||.|::.:.:...|:|:|||..|..:  :..:.....|||||
  Fly   260 SR-IKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWG 323

  Fly   258 TLKEDG--KPSCLLQEVEVPVLDNDECVAQTNYTQK----MITKNMMCSGYPGVGGRDSCQGDSG 316
            | ||.|  |...:|:.:.:|:::.:||.|:...|:.    .:..:.:|:|  |..|:|:|:||.|
  Fly   324 T-KEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAG--GDPGKDTCKGDGG 385

  Fly   317 GPLVRLRPDD-KRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENSR 365
            .||....|.: .|::.:||||||..||..:.|.||..|.....||.|..|
  Fly   386 SPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKIR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 80/255 (31%)
Tryp_SPc 128..363 CDD:238113 82/257 (32%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 80/241 (33%)
Tryp_SPc 197..430 CDD:214473 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.