DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and SPH93

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:287 Identity:94/287 - (32%)
Similarity:143/287 - (49%) Gaps:20/287 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NPIKNWFGAFNRNNSPAAQNQTSPTCSCRCGERNDES-RIVGGTT---TGVSEYPWMARLSYFNR 150
            ||..|:....|...:|.....:|...|..||..|... ::|.|.|   ...::|||...:.:..:
  Fly   204 NPTTNFGNPTNNGGNPTTNVGSSELLSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQ 268

  Fly   151 FYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCNDKE--RPETRFVLRA-FSQKFSFSNF 212
            :..||:||....|||.||.|......:: |..|:.|..:|:|  ..|.|.|.|| ..:.|.|.:.
  Fly   269 YLAGGSLIQPNVVLTVAHRVITIETELV-VRAGDWDLKSDREIFLSEQREVERAVIHEGFDFKSG 332

  Fly   213 DNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLK-EDGKPSCLLQEVEVPV 276
            .|::|||.||....:...||.||||...:.   |.|.:....|||.:: ||.:.|.:|::|::.|
  Fly   333 ANNLALLFLNSPFKLNDHIRTICLPTPNKS---FAGRRCTVAGWGKMRYEDQRYSTVLKKVQLLV 394

  Fly   277 LDNDEC---VAQTNYTQKM-ITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKR--FEQIGIV 335
            ::.:.|   :..|....|. :.||::|:|  |..|||:|.||.|..|......:..  :||.|||
  Fly   395 VNRNVCEKFLRSTRLGAKFELPKNIICAG--GELGRDTCTGDGGSALFCSIGGENSGVYEQAGIV 457

  Fly   336 SWGNGCARPNYPGVYTRVTKYLDWIVE 362
            :||.||.:...|.:||.|:|:.:||.|
  Fly   458 NWGVGCGQEGIPAIYTEVSKFTNWITE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 81/245 (33%)
Tryp_SPc 128..363 CDD:238113 84/248 (34%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 81/241 (34%)
Tryp_SPc 252..482 CDD:214473 78/235 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.