DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG4793

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:363 Identity:102/363 - (28%)
Similarity:146/363 - (40%) Gaps:89/363 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KYQALGAAHHQAK------KLKIGDVNASSSDANKPVFRQNPIKNWFGAFNRNNSPA-------- 106
            :.|||......||      :.:||      ::..:|:..       |...|..|...        
  Fly    15 RIQALFCGGSMAKECVQRNRCRIG------TETGRPIID-------FRGLNNGNQGCESGQTCCP 66

  Fly   107 ----------AQNQTSPTCSCRCGERNDESRI-VGGTTTGV------SEYPWM-ARLSYFNRF-Y 152
                      |.||..||   .||..|   || ||.|.|..      .|.||| |.|...:|. .
  Fly    67 KTEILQYPVQADNQPLPT---ECGHVN---RIGVGFTITNARDIAQKGELPWMVALLDSRSRLPL 125

  Fly   153 CGGTLINDRYVLTAAH----------CVKGFMWFMIKVTFGEHDRCNDKERPETRFVLRAFSQ-- 205
            .||:||....|||::.          .|:...|....:|         :||......:|...:  
  Fly   126 GGGSLITRDVVLTSSTKTLEVPEKYLIVRAGEWDFESIT---------EERAHEDVAIRKIVRHT 181

  Fly   206 KFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKE-DGKPSCLL 269
            ..|..|..|:.|||.|...:.:...|..||||...:.   |:..:.|.:|||.... |.....:|
  Fly   182 NLSVENGANNAALLFLARPLKLDHHIGLICLPPPNRN---FIHNRCIVSGWGKKTALDNSYMNIL 243

  Fly   270 QEVEVPVLDNDECVA--QTNYTQKMITKN-MMCSGYPGVGGRDSCQGDSGGPLV-RLRPDDKRFE 330
            :::|:|::|...|..  |..|.:..|..| ::|:|  |..|:|:|:||.|.||. .|:.|..|:|
  Fly   244 KKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAG--GEPGKDTCKGDGGAPLACPLQSDPNRYE 306

  Fly   331 QIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENSRDGC 368
            .:|||::|.||..| .|..||.|::...||     |.|
  Fly   307 LLGIVNFGFGCGGP-LPAAYTDVSQIRSWI-----DNC 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 79/258 (31%)
Tryp_SPc 128..363 CDD:238113 80/260 (31%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 75/251 (30%)
Tryp_SPc 105..335 CDD:214473 73/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.