DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and PRSS48

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:302 Identity:96/302 - (31%)
Similarity:142/302 - (47%) Gaps:57/302 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PIKNW-FGAFNRNNSPAAQNQTS--------PTCSCRCGERNDESRIVGGTTTGVSEYPWMARLS 146
            |...| ||    |:......:|.        .:.|..||:....||:|||.......:||...|.
Human     9 PRNRWEFG----NDDKVGTRETGLLGFHISLSSLSLVCGQPVYSSRVVGGQDAAAGRWPWQVSLH 69

  Fly   147 YFNRFYCGGTLINDRYVLTAAHCVK------GFMWFMIKVTFGEHDRCNDKERPETRFVLRAFSQ 205
            :.:.|.|||:|:::|.:||||||::      .:..::..:|.|:       .|...::.:.....
Human    70 FDHNFICGGSLVSERLILTAAHCIQPTWTTFSYTVWLGSITVGD-------SRKRVKYYVSKIVI 127

  Fly   206 KFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIA-------TGWGTLKE-- 261
            ...:.:...|:|||:|:.:|..||.|.|||||.|         ||.:|       ||||.:||  
Human   128 HPKYQDTTADVALLKLSSQVTFTSAILPICLPSV---------TKQLAIPPFCWVTGWGKVKESS 183

  Fly   262 DGKPSCLLQEVEVPVLDNDECVAQTN-------YTQKMITKNMMCSGYPGVGGRDSCQGDSGGPL 319
            |......|||.|||::|...|....|       ..:.:|.::.:|:| .....:|||:|||||||
Human   184 DRDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEPVIKEDKICAG-DTQNMKDSCKGDSGGPL 247

  Fly   320 -VRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
             ..:   |..:.|.|:||||..|.: :.|||||.|..|..||
Human   248 SCHI---DGVWIQTGVVSWGLECGK-SLPGVYTNVIYYQKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 84/255 (33%)
Tryp_SPc 128..363 CDD:238113 85/256 (33%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 84/255 (33%)
Tryp_SPc 51..288 CDD:238113 85/256 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.