DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and prss60.3

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:248 Identity:101/248 - (40%)
Similarity:138/248 - (55%) Gaps:14/248 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERNDESRIVGGTTTGVSEYPWMARL--SYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVT 181
            ||:....:|||||.......:||...|  ..:...:|||:||:..:|||||||:.|.....:.|.
Zfish    27 CGQAPLNTRIVGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVY 91

  Fly   182 FGEHDRCNDKERPETRFVLRAF-SQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDL 245
            .|...:........:|.|.::| ...::.:..|||||||||:..|..|::|||:||  ..|....
Zfish    92 LGRRTQQGINIYETSRNVAKSFVHSSYNSNTNDNDIALLRLSSAVTFTNYIRPVCL--AAQNSVY 154

  Fly   246 FVGTKAIATGWGTLKED-GKPS-CLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGR 308
            ..||.:..||||.::.. ..|: .:|||..:||:.||.|.|...  ...:|.||:|:|.. .||:
Zfish   155 SAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRCNALLG--SGTVTNNMICAGLT-QGGK 216

  Fly   309 DSCQGDSGGPLV-RLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
            |:||||||||:| ||   ...:.|.||.|||.|||.||.|||||||::|..||
Zfish   217 DTCQGDSGGPMVTRL---CTVWVQAGITSWGYGCADPNSPGVYTRVSQYQSWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 97/238 (41%)
Tryp_SPc 128..363 CDD:238113 98/239 (41%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 98/239 (41%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.