DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG3117

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:246 Identity:82/246 - (33%)
Similarity:127/246 - (51%) Gaps:14/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 DESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRC 188
            |.|..|.|..|..:::||:..|.....:..||:||....||||||.:.|.....|.|..||.|..
  Fly    88 DGSPQVFGDQTKPNQFPWVTALFAKGSYLGGGSLITPGLVLTAAHILAGLSPNDIMVRAGEWDLS 152

  Fly   189 NDKE--RPETRFVLRAFS-QKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTK 250
            :.::  .|..|.|::... :.|::|:..||:|||.|:....:.:.|:.|.||..::..|..:.|.
  Fly   153 SSEKLNPPMDRQVIKIMEHEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRICTV 217

  Fly   251 AIATGWGTLKE-DGKPSCLLQEVEVPVLDNDECVAQTNYTQK----MITKNMMCSGYPGVGGRDS 310
            |   |||.... |.....:.|:|::||:::.:|..|...|:.    .:..::||:|  |..|||.
  Fly   218 A---GWGMRSSTDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAG--GEEGRDV 277

  Fly   311 CQGDSGGPL-VRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
            |....|..| ..|..|..|:||.||||:|.||.:.|.|..:|.|:|:::||
  Fly   278 CSLFGGFALFCSLDDDPNRYEQAGIVSFGVGCGQANVPTTFTHVSKFMEWI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 78/241 (32%)
Tryp_SPc 128..363 CDD:238113 80/242 (33%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 79/239 (33%)
Tryp_SPc 95..328 CDD:214473 77/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.