DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG18557

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:392 Identity:93/392 - (23%)
Similarity:144/392 - (36%) Gaps:101/392 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WPLVLAMASCLLFTAATSATPATPATPATSAPPATSTATSSLSSIPGKYQALGAAHHQAKKLKIG 73
            |..|:.:..|......|.|...............||....:..|.|...|...:..|.::||.||
  Fly     2 WRRVIFIRCCFWTLTETGAPCGLQMECVPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLVIG 66

  Fly    74 DVNASSSDANKPVFRQNPIKNWFGAFNRNNSPAAQNQTSPTCSCRCGERNDESRIVGGTTTGV-- 136
                                                     ....||:.|...  :|||...|  
  Fly    67 -----------------------------------------APLNCGKSNPNG--LGGTVEEVVD 88

  Fly   137 ----SEYPW-MARLSYFNRFYCGGTLINDRYVLTAAHC----------VKGFMWFMIKVTFGEHD 186
                :|:|| :|.:.....|:..|||:.:..|:||||.          :.|..| .:|...|:  
  Fly    89 QAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAW-DLKQLAGK-- 150

  Fly   187 RCNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSF-----IRPICLPRVEQRQDLF 246
              ..:.|..||.|......|.:.:   |:|||:.|.     |||     |.|||.|.....   |
  Fly   151 --TIQWRTATRIVSHPDFNKMTGA---NNIALIVLE-----TSFVMKPPIGPICWPTSGVS---F 202

  Fly   247 VGTKAIATGWGTLKEDGKPSCLL-------QEVEVPVLDNDEC---VAQTNYTQK-MITKNMMCS 300
            ...:.:..||      |:|..|.       :::::|::...:|   :.:|.:.|. .:...::|:
  Fly   203 DRERCLVAGW------GRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCA 261

  Fly   301 GYPGVGGRDSCQGDSGGPLVRLRPDDKR-FEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENS 364
            |  |..|||:|.||.|.||:...|.... :|.:|||:.|..|...|.|.:||.::....||.:..
  Fly   262 G--GERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQL 324

  Fly   365 RD 366
            .|
  Fly   325 ND 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 72/266 (27%)
Tryp_SPc 128..363 CDD:238113 74/268 (28%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 70/258 (27%)
Tryp_SPc 90..320 CDD:214473 68/253 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.