DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG11911

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:257 Identity:77/257 - (29%)
Similarity:118/257 - (45%) Gaps:51/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IVGGTTTGVSEYPWMARL--SYFNRFY-CGGTLINDRYVLTAAHCVK---GFMWFMIKVTFGEHD 186
            ::.||.......|::..|  :|....: |||||||..:::|||||:.   |     :.:..|.|.
  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVG-----MSIIAGLHT 96

  Fly   187 RCNDKERPETRFV-LRAFSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQD----LF 246
            |....|..:.|.| .....:|::......|||||.:|:......:::|..||..||..:    |:
  Fly    97 RAEVDELTQQRQVDFGRVHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLY 161

  Fly   247 VGTKAIATGWGTLKE---DGKPSCLLQEVEVPVLDNDEC---------VAQTNYTQKMITKNMMC 299
                    |||..|.   .|..:  ||.|...:|:.:||         :|::|.....:.::   
  Fly   162 --------GWGQPKSYIFSGAKT--LQTVTTQILNYEECKEELPESAPIAESNICSSSLQQS--- 213

  Fly   300 SGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGN-GCARPNYPGVYTRVTKYLDWI 360
                    :.:|.|||||||| :...:...|.|||||||. .|...|.|.:||:|:.|:|||
  Fly   214 --------KSACNGDSGGPLV-VEFTNAPSELIGIVSWGYIPCGLANMPSIYTKVSAYIDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 75/255 (29%)
Tryp_SPc 128..363 CDD:238113 77/257 (30%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 77/257 (30%)
Tryp_SPc 37..266 CDD:214473 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.