DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Prss34

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:259 Identity:93/259 - (35%)
Similarity:142/259 - (54%) Gaps:42/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IVGGTTTGVSEYPWMARLSYFNRFY------CGGTLINDRYVLTAAHCV--KGFMWFMIKVTFGE 184
            ||||.....|.:||...|..::..:      |||:||:.::||||||||  |....:.::|..|:
Mouse    35 IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVRPKEVEAYGVRVQVGQ 99

  Fly   185 HDRCNDKERPETRFVLR--AFSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLP----RVEQRQ 243
            .....:.:..:...::|  .||:|.| :....|||||:|:.||.::..:.|:.||    |:..::
Mouse   100 LRLYENDQLMKVVKIIRHPKFSEKLS-ARGGADIALLKLDTRVVLSEHVYPVSLPAASLRISSKK 163

  Fly   244 DLFVGTKAIATGWGTLKE--DGKPSCLLQEVEVPVLDNDECVA--QTN----YTQKMITKNMMCS 300
            ..:|      .|||.::.  ...|...|:||.||:::|::|..  |||    .|.::|..:|:|:
Mouse   164 TCWV------AGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTTRIIKDDMLCA 222

  Fly   301 GYPGVGGRDSCQGDSGGPLVRLRPDDKRFE----QIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
            |..   |||||:.|||||||      .|:.    |:|:||||.||..|::|||||||..|:.||
Mouse   223 GKE---GRDSCKADSGGPLV------CRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 91/257 (35%)
Tryp_SPc 128..363 CDD:238113 93/259 (36%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 93/259 (36%)
Tryp_SPc 35..277 CDD:214473 91/257 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.