DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and tmprss4b

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001119849.1 Gene:tmprss4b / 327651 ZFINID:ZDB-GENE-030131-5862 Length:432 Species:Danio rerio


Alignment Length:285 Identity:104/285 - (36%)
Similarity:148/285 - (51%) Gaps:40/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QNPIKNWFGAFNRNNSPAAQNQTSPTCSCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYC 153
            |:.|:::..|.|:.:|.:.   .|.:|| .|||...|.|||||..|.:..:||...|.:.:|..|
Zfish   167 QSDIQSFLSASNKCSSGSV---VSVSCS-DCGEVVGEDRIVGGVETSIEHWPWQVSLQFNHRHMC 227

  Fly   154 GGTLINDRYVLTAAHCVKG-----FMWFMIKVTFGEHDRCNDKERPETRFV--------LRAFSQ 205
            ||:|::..::::||||..|     ..|   .|..|           :|:.:        :....:
Zfish   228 GGSLLSTSWIISAAHCFTGRTQELSRW---TVVLG-----------QTKVMDVVGVSVDMIVIHK 278

  Fly   206 KFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQ 270
            .::....|.|||:|:|...|.....|.|:|||    ...|.:....:.||||.|||.|....:||
Zfish   279 DYNRLTNDFDIAMLKLTWPVKTGESILPVCLP----PHQLAIKDMLVVTGWGLLKEGGALPTVLQ 339

  Fly   271 EVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIV 335
            :..||:::..||...|.|:.. ||..|:|:|:. .|..|:||||||||||.|   ..|::.||||
Zfish   340 KASVPLVNRSECSKPTIYSSS-ITPRMLCAGFL-QGNVDACQGDSGGPLVYL---SSRWQLIGIV 399

  Fly   336 SWGNGCARPNYPGVYTRVTKYLDWI 360
            |||.||||...||||..||:.||||
Zfish   400 SWGVGCAREGKPGVYADVTQLLDWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 90/245 (37%)
Tryp_SPc 128..363 CDD:238113 91/246 (37%)
tmprss4bNP_001119849.1 SRCR_2 100..179 CDD:292133 3/11 (27%)
SRCR 105..>175 CDD:278931 2/7 (29%)
Tryp_SPc 201..424 CDD:214473 90/245 (37%)
Tryp_SPc 202..427 CDD:238113 91/246 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I4005
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6379
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.