DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG33160

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:250 Identity:80/250 - (32%)
Similarity:121/250 - (48%) Gaps:37/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCN 189
            :.||:||..:.:.|..::.:::..... |||:|:..|:|:||||||    :...|..|..:...:
  Fly    31 QPRIIGGHVSSIKEEKYLVQVTTSEEL-CGGSLVKPRWVITAAHCV----YNKNKNDFKIYGGAS 90

  Fly   190 DKERPETRFVLR-----AFSQKFSFSNFDNDIALLRLN-DRVPITSFIRPICLPRVEQRQDLFVG 248
            ::..|..  |:|     |....|:....:.|:|.|||| |.:.......|:....|..|..:.| 
  Fly    91 NQAGPYA--VIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPARALVKV- 152

  Fly   249 TKAIATGWGTLKEDG-KPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSG--YPGVGGRDS 310
                 :|||.|..|. |.:..:..|.||:.....||:......: ||::|:|:.  |.    :||
  Fly   153 -----SGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHR-ITRSMVCAARLYK----KDS 207

  Fly   311 CQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDW---IVE 362
            |.||||||||      .|.:..||||:|.|||.. .||:||.|.:..||   :||
  Fly   208 CDGDSGGPLV------YRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 78/244 (32%)
Tryp_SPc 128..363 CDD:238113 78/246 (32%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 76/240 (32%)
Tryp_SPc 34..253 CDD:238113 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.