DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and f2

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_005169022.1 Gene:f2 / 325881 ZFINID:ZDB-GENE-030131-4606 Length:635 Species:Danio rerio


Alignment Length:295 Identity:110/295 - (37%)
Similarity:149/295 - (50%) Gaps:54/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGER-----------NDE--------SRIVGGTTTGVSEYPWMARLSYFNR----FYCGGTLIND 160
            ||||           |::        ||||||....|:..||...|  :.|    ..||.:||:|
Zfish   346 CGERPLFEKINKADKNEKELLMSYTGSRIVGGDEAEVASAPWQVML--YKRSPQELLCGASLISD 408

  Fly   161 RYVLTAAHCV------KGFMWFMIKVTFGEHDRCNDKERPETRFVLRAFSQ-----KFSF-SNFD 213
            .::||||||:      |.|....|.|..|:|.| ...||...:.|  |..:     |::: .|.:
Zfish   409 EWILTAAHCILYPPWNKNFTINDIIVRLGKHSR-TKYERGIEKIV--AIDEIIVHPKYNWKENLN 470

  Fly   214 NDIALLRLNDRVPITSFIRPICLPRVEQRQDL-FVGTKAIATGWGTLKED--GKPSCL---LQEV 272
            .|||||.:...|..||.|.|:|||.....::| |.|.|...||||.|:|.  ..|:.|   ||::
Zfish   471 RDIALLHMKKPVVFTSEIHPVCLPTKSIAKNLMFAGYKGRVTGWGNLRESWTSNPTNLPTVLQQI 535

  Fly   273 EVPVLDNDECVAQTNYTQKMITKNMMCSGY-PGVGGR-DSCQGDSGGPLVRLRPDDKRFEQIGIV 335
            .:|::|...|   .|.|..:||.||.|:|| |....| |:|:||||||.|...|.|.|:.|||||
Zfish   536 HLPIVDQSIC---RNSTSVIITDNMFCAGYQPDDSKRGDACEGDSGGPFVMKSPSDNRWYQIGIV 597

  Fly   336 SWGNGCARPNYPGVYT---RVTKYLDWIVENSRDG 367
            |||.||.|....|.||   |:.:::..::|.:..|
Zfish   598 SWGEGCDRDGKYGFYTHLFRMRRWMKKVIEKTDSG 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 102/259 (39%)
Tryp_SPc 128..363 CDD:238113 101/261 (39%)
f2XP_005169022.1 GLA 39..100 CDD:214503
KR 126..206 CDD:214527
KR 228..309 CDD:214527
Thrombin_light 326..373 CDD:286482 5/26 (19%)
Tryp_SPc 373..621 CDD:214473 102/255 (40%)
Tryp_SPc 374..625 CDD:238113 101/258 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.