DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Tmprss3

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:268 Identity:95/268 - (35%)
Similarity:136/268 - (50%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 CSCRCGERNDES-RIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCV-------- 170
            ||. ||.|...| |||||..:.::::||...|.:.....|||::|...:::||||||        
  Rat   204 CSA-CGMRTGYSPRIVGGNVSSLTQWPWQVSLQFQGYHLCGGSVITPLWIVTAAHCVYDLYHPKS 267

  Fly   171 ----KGFMWFMIKVTFGEHDRCNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFI 231
                .|.:..|            |...|........:..|:......|||||::|::.:.....|
  Rat   268 WTVQVGLVSLM------------DSPVPSHLVEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETI 320

  Fly   232 RPICLPRVEQR-QDLFVGTKAIATGWGTLKED-GKPSCLLQEVEVPVLDNDECVAQTNYTQKMIT 294
            :|||||..|:. .|   |.....:|||..::. |..|.:|....||::.|..|..:..| ..:|:
  Rat   321 QPICLPNSEENFPD---GKLCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVY-GGIIS 381

  Fly   295 KNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDW 359
            .:|:|:||. .||.||||||||||||  ..:.:.::.:|..|:|.|||..|.||||||:|.:|||
  Rat   382 PSMLCAGYL-KGGVDSCQGDSGGPLV--CQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDW 443

  Fly   360 IVEN-SRD 366
            |.|. .||
  Rat   444 IHEQLERD 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 84/246 (34%)
Tryp_SPc 128..363 CDD:238113 85/248 (34%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 4/7 (57%)
Tryp_SPc 216..444 CDD:214473 84/246 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.