DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and F10

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:270 Identity:96/270 - (35%)
Similarity:139/270 - (51%) Gaps:45/270 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NQTSPTCSCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNRF-------YCGGTLINDRYVLTA 166
            |:|.|..:     .:|..|||||......|.||.|.|     |       :||||::|:.|:|||
  Rat   218 NKTEPEAN-----SDDVIRIVGGQECKRGECPWQALL-----FSDEETDGFCGGTILNEFYILTA 272

  Fly   167 AHCVKGFMWFMIKVTFGEHDRCNDKERP------ETRFVLRAFSQKFSFSNFDNDIALLRLNDRV 225
            |||:.....|.::|  |:   .|.::..      |...:::  ..||....:|.|||:|||...:
  Rat   273 AHCLHQAKRFKVRV--GD---LNTEQEDGGEMVHEVDMIIK--HNKFQRDTYDFDIAMLRLKTPI 330

  Fly   226 PITSFIRPICLPRVEQRQDLFVGTK-AIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYT 289
            .....:.|.|||:.:..:...:..| .|.:|:|...|.|:.|.:|:.:|||.:|.:.|...|:::
  Rat   331 TFRENVAPACLPQKDWAEATLMTQKTGIVSGFGRTHEKGRQSKVLKMMEVPYVDRNTCRLSTSFS 395

  Fly   290 QKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQ----IGIVSWGNGCARPNYPGVY 350
               ||:||.|:|| .....|:||||||||.|      .||:.    .||||||.||||....|:|
  Rat   396 ---ITQNMFCAGY-DAKQEDACQGDSGGPHV------TRFKDTYFVTGIVSWGEGCARKGKYGIY 450

  Fly   351 TRVTKYLDWI 360
            |:||.:|.||
  Rat   451 TKVTAFLKWI 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 90/250 (36%)
Tryp_SPc 128..363 CDD:238113 91/251 (36%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372
Tryp_SPc 232..462 CDD:238113 91/251 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12321
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.