DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Tmprss11g

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001008554.1 Gene:Tmprss11g / 289546 RGDID:1306446 Length:417 Species:Rattus norvegicus


Alignment Length:262 Identity:89/262 - (33%)
Similarity:137/262 - (52%) Gaps:20/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 AAQNQTSPTCSCRCG-ERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHC 169
            |||.:.....:|..| |....:||..|...|.:.:||.:.|.......||.:||..::::|:|||
  Rat   163 AAQAEHILNSNCGLGMEYPRIARIADGKPAGSNSWPWQSSLQVEGIHLCGASLIGSQWLVTSAHC 227

  Fly   170 VKGF----MWFMIKVTFGEHDRCNDKERPETRFVLRA--FSQKFSFSNFDNDIALLRLNDRVPIT 228
            ...:    :|   .|:||     .....|.|...:.:  ..:.::....|:|||:::|:..|..:
  Rat   228 FDNYKNPKLW---TVSFG-----RTLGNPLTTRKVESIIIHENYAAHKHDDDIAVVKLSSPVLFS 284

  Fly   229 SFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMI 293
            ..:|.:|||  |....:...:|...||||.||.:|.....|||||:.::.||.| .|.|.....|
  Rat   285 ENLRTVCLP--EATFQVLPKSKVFVTGWGALKANGPFPNSLQEVEIEIISNDVC-NQVNVYGGAI 346

  Fly   294 TKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLD 358
            :..|:|:|:. .|..|:|:|||||||| :..:..::..:||||||..|.:.|.||:|||||.|.:
  Rat   347 SSGMICAGFL-TGKLDACEGDSGGPLV-ISDNRNKWYLLGIVSWGIDCGKENKPGIYTRVTHYRN 409

  Fly   359 WI 360
            ||
  Rat   410 WI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 81/238 (34%)
Tryp_SPc 128..363 CDD:238113 82/239 (34%)
Tmprss11gNP_001008554.1 SEA 48..142 CDD:279699
Tryp_SPc 185..411 CDD:214473 81/238 (34%)
Tryp_SPc 186..414 CDD:238113 82/239 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.