DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Prss34

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:259 Identity:96/259 - (37%)
Similarity:137/259 - (52%) Gaps:42/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IVGGTTTGVSEYPWMARLSYFN------RFYCGGTLINDRYVLTAAHCV--KGFMWFMIKVTFGE 184
            ||||.....|.:||...|.::|      ...|||:||:.::||||||||  |.......:|..|:
  Rat    33 IVGGCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQ 97

  Fly   185 HDRCNDKERPETRFVLR--AFSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFV 247
            .....:.:..:...::|  .||:|.|... ..|||||:|:..|.::..:.|:.||...||    :
  Rat    98 LRLYENDQLMKVAKIIRHPKFSEKLSAPG-GADIALLKLDSTVVLSERVHPVSLPAASQR----I 157

  Fly   248 GTKAI--ATGWGTLKEDG----KPSCLLQEVEVPVLDNDEC------VAQTNYTQKMITKNMMCS 300
            .:|..  ..|||.:  :|    .|.|.|:||.||::.|.:|      .:..:.|.|:|..:|:|:
  Rat   158 SSKKTWWVAGWGVI--EGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCA 220

  Fly   301 GYPGVGGRDSCQGDSGGPLVRLRPDDKRFE----QIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
               |:.||||||.|||||||      .|:.    |:|:||||.||..|::|||||||..||.||
  Rat   221 ---GMEGRDSCQADSGGPLV------CRWNCSWVQVGVVSWGIGCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 94/257 (37%)
Tryp_SPc 128..363 CDD:238113 96/259 (37%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 96/259 (37%)
Tryp_SPc 33..275 CDD:214473 94/257 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.