DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Prss27

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:260 Identity:90/260 - (34%)
Similarity:129/260 - (49%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMI-KVTF 182
            ||.....:|:|||......|:||...:......:|||:||...:|||||||........| :|..
  Rat    29 CGHPRMFNRMVGGEDALEGEWPWQVSIQRNGAHFCGGSLIAPTWVLTAAHCFSNTSDISIYQVLL 93

  Fly   183 GEHDRCNDKERPETRFVLRAFSQKFSFSNFDN-----DIALLRLNDRVPITSFIRPICLPRVEQR 242
            |    ....::|....:.....:..|...:..     |:||:.|...|..|.:|.|:|||     
  Rat    94 G----ALKLQQPGPHALYVPVKRVKSHPEYQGMASSADVALVELQVPVTFTKYILPVCLP----- 149

  Fly   243 QDLFV----GTKAIATGWGTLKE-DGKPS-CLLQEVEVPVLDNDEC------VAQTNYTQKMITK 295
             |..|    |.....||||:..| |..|: .:||::.||::|..:|      .|:.:...|.|..
  Rat   150 -DPSVVFKSGMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKCNLLYSKDAEADIQLKTIKD 213

  Fly   296 NMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
            :|:|:|: ..|.:|:|:||||||||.|  .|:.:.|.|::|||.||||.|.||||.||..:..||
  Rat   214 DMLCAGF-AEGKKDACKGDSGGPLVCL--VDQSWVQAGVISWGEGCARRNRPGVYIRVASHYQWI 275

  Fly   361  360
              Rat   276  275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 86/250 (34%)
Tryp_SPc 128..363 CDD:238113 87/251 (35%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 86/250 (34%)
Tryp_SPc 39..278 CDD:238113 87/250 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.