DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and f7i

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_775335.1 Gene:f7i / 282671 ZFINID:ZDB-GENE-021206-10 Length:443 Species:Danio rerio


Alignment Length:291 Identity:91/291 - (31%)
Similarity:127/291 - (43%) Gaps:61/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TCSCR-------------------CG-----ERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCG 154
            :|||.                   ||     :...:::.:||........||...:.|.....||
Zfish   148 SCSCAEGYALADDGTSCVSQVDYPCGKIPVQKNTSQNQFLGGIHCPRGHCPWQVLIDYNGESVCG 212

  Fly   155 GTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDR--CNDKERPETRFVLRAFSQKFSFSNF----- 212
            |.|:...:::||||||.......:|...||||.  .:..|.|      ...|..|...|:     
Zfish   213 GALLEGPWLITAAHCVHQKDTRFLKAVTGEHDLDVLDGSEEP------YEVSAVFIHPNYDPETL 271

  Fly   213 DNDIALLRLNDRVPI--TSFIRPICLPRVE-QRQDLFVGTKAIATGWGT------LKED----GK 264
            |:|:|||||  |||:  :.:..|||||..: .|.:|:.......:||||      |:.:    |.
Zfish   272 DSDLALLRL--RVPVQRSLYAVPICLPTPQLARSELWAARFHTLSGWGTRTAGHNLRREKGLKGP 334

  Fly   265 PSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRF 329
            .|..||.:.||:|...:| ...|     .|.||.|:||. .|...||:|..|.||| .|..:..|
Zfish   335 ASGTLQRLAVPLLPAAQC-GNAN-----TTANMFCAGYT-EGDHASCRGHDGSPLV-TRYGETSF 391

  Fly   330 EQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
             ..|:||||.||..|.|..:||:|..:|.|:
Zfish   392 -LTGVVSWGRGCGPPGYYWIYTKVENFLIWM 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 85/252 (34%)
Tryp_SPc 128..363 CDD:238113 86/253 (34%)
f7iNP_775335.1 GLA 20..82 CDD:214503
EGF_CA <91..120 CDD:238011
FXa_inhibition 129..164 CDD:291342 3/15 (20%)
Tryp_SPc 188..420 CDD:214473 85/248 (34%)
Tryp_SPc 188..420 CDD:238113 85/248 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.