DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG33225

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:265 Identity:94/265 - (35%)
Similarity:129/265 - (48%) Gaps:41/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 CGERNDESRI---VGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKV 180
            ||.....|||   |||........|||..:...|..:|.|:||...:|||:|.|:   :....:|
  Fly    45 CGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLITRLFVLTSASCL---LSLPKQV 106

  Fly   181 TFGEHDR-CNDKERPETRFVLRAFSQKFSFSNF------DNDIALLRLNDRVPITSFIRPICLPR 238
            ..||:|| |...:....|.|: ...||.....|      ..|||||||..:|.|:.::|||||  
  Fly   107 ILGEYDRNCTSADCTSIRQVI-DIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICL-- 168

  Fly   239 VEQRQDLFVGTKA---IATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCS 300
               ..|..||...   .|||||| .|..:||.:||.|.:..::...|..:   .::.|..:.:|.
  Fly   169 ---SVDRQVGRSVQHFTATGWGT-TEWNEPSTILQTVTLSKINRKYCKGR---LRQNIDASQLCV 226

  Fly   301 GYPGVGGRDSCQGDSGGPL---VRLRPDDK-----RFEQIGIVSWG-NGCARPNYPGVYTRVTKY 356
            |.|   .:|:|.||:||||   :::..|.|     |...|||||:| :.|:.   .||||.|..|
  Fly   227 GGP---RKDTCSGDAGGPLSLTLKIDGDGKWNNKSRAFLIGIVSYGSSSCSG---IGVYTNVEHY 285

  Fly   357 LDWIV 361
            :||||
  Fly   286 MDWIV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 88/254 (35%)
Tryp_SPc 128..363 CDD:238113 90/256 (35%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 86/251 (34%)
Tryp_SPc 57..292 CDD:238113 89/253 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.