DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and CG33226

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:283 Identity:86/283 - (30%)
Similarity:125/283 - (44%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RNNSPAAQNQTSPTC-SCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVL 164
            |:.....|:...|.| ....|.|   .:|:||....:..:|||.::......:|||:||:..:||
  Fly    22 RSYESLGQDLLDPNCVQTPVGVR---EQILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVL 83

  Fly   165 TAAHCVKGFMWFMIKVTFGEHDRCNDKERPETRF---------VLRAFSQKFSFSNFDN-DIALL 219
            |||||   ...:.:||.||.:.....:....:::         |.|.|... |:.::.| ||||.
  Fly    84 TAAHC---HSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHS-SYRDYHNYDIALF 144

  Fly   220 RLNDRVPITSFIRPICLPRVEQRQDL--FVGTKAI--ATGWGTLKEDGKPSCLLQEVEVPVLDND 280
            .|...|......||||:.:...:..|  |:...|:  .||||. .|....|.:||...:..||..
  Fly   145 LLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGK-TESQLTSTILQTTSLFHLDRK 208

  Fly   281 ECVAQTNYTQKMITKNMMCSGYP----GVGGRDSCQGDSGGPL-VRLR-PDDKRFEQIGIVSWGN 339
            .| ||. :.:|:        |:|    |.....:|.||||||| ..|. ...||....||:|:| 
  Fly   209 FC-AQI-FDRKI--------GWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYG- 262

  Fly   340 GCARPN--YPGVYTRVTKYLDWI 360
               .||  ...|:|.|.:|.:||
  Fly   263 ---APNCREVTVFTNVLRYSNWI 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 78/254 (31%)
Tryp_SPc 128..363 CDD:238113 80/255 (31%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 80/255 (31%)
Tryp_SPc 47..282 CDD:214473 78/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.