DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and F7

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_690059.1 Gene:F7 / 260320 RGDID:628678 Length:446 Species:Rattus norvegicus


Alignment Length:309 Identity:99/309 - (32%)
Similarity:146/309 - (47%) Gaps:49/309 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 NRNNSPAAQNQ-------------TSPTCSCR-------------------CG------ERN--- 123
            |:|......|:             |..||||.                   ||      :||   
  Rat   125 NKNEQLICANENGDCDQYCRDHVGTKRTCSCHEDYVLQPDEVSCKPKVEYPCGRIPVVEKRNFSR 189

  Fly   124 DESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFM-IKVTFGEHDR 187
            .:.|||||......|.||.|.|.:.....||..|::.|:::|||||...|...: |.|..||||.
  Rat   190 PQGRIVGGYVCPKGECPWQAVLKFNEALLCGAVLLDTRWIVTAAHCFDKFGKLVNITVVLGEHDF 254

  Fly   188 CNDKERPETRFVLRA-FSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTK- 250
            ...:...:.|.|.:. ...|::....|:||||:||:..|..|.::.|:|||.....::.....: 
  Rat   255 SEKEGTEQVRLVEQVIMPNKYTRGRTDHDIALVRLHRPVTFTDYVVPLCLPERAFSENTLASIRF 319

  Fly   251 AIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQK--MITKNMMCSGYPGVGGRDSCQG 313
            :..:|||.|.:.|..:..|..:|||.|...:|:....::..  .||:||.|:||.. |.:|:|:|
  Rat   320 SRVSGWGQLLDRGATALELMVIEVPRLMTQDCLEHAKHSANTPRITENMFCAGYMD-GTKDACKG 383

  Fly   314 DSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVE 362
            |||||  ........:...|:||||.|||...:.||||||::|:||:|:
  Rat   384 DSGGP--HATHYHGTWYLTGVVSWGEGCAAIGHIGVYTRVSQYIDWLVK 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 85/237 (36%)
Tryp_SPc 128..363 CDD:238113 86/240 (36%)
F7NP_690059.1 GLA 25..85 CDD:214503
EGF_CA 87..123 CDD:238011
Tryp_SPc 194..430 CDD:238113 85/238 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12321
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.