DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and F9

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_113728.1 Gene:F9 / 24946 RGDID:2589 Length:462 Species:Rattus norvegicus


Alignment Length:246 Identity:84/246 - (34%)
Similarity:136/246 - (55%) Gaps:11/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 NDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDR 187
            ||.:|:|||......:.||...|:.....:|||.:||:::::|||||:|  ....|:|..|||:.
  Rat   223 NDFTRVVGGENAKPGQIPWQVILNGEIEAFCGGAIINEKWIVTAAHCLK--PGDKIEVVAGEHNI 285

  Fly   188 CNDKERPETRFVLRAF---SQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGT 249
            ...::..:.|.|:|..   ....:.:.:.:|||||.|:..:.:.|::.|||:...|.........
  Rat   286 DEKEDTEQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPICVANKEYTNIFLKFG 350

  Fly   250 KAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGD 314
            ....:|||.:...|:.:.:||.:.||::|...|:..|.::   |..||.|:|| ..||:|||:||
  Rat   351 SGYVSGWGKVFNKGRQASILQYLRVPLVDRATCLRSTKFS---IYNNMFCAGY-REGGKDSCEGD 411

  Fly   315 SGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENSR 365
            ||||.| ...:...| ..||:|||..||.....|:||:|::|::||.|.::
  Rat   412 SGGPHV-TEVEGTSF-LTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTK 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 79/235 (34%)
Tryp_SPc 128..363 CDD:238113 80/237 (34%)
F9NP_113728.1 GLA 21..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 227..455 CDD:214473 79/235 (34%)
Tryp_SPc 228..458 CDD:238113 80/237 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12321
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.