DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_766468.1 Gene:Tmprss11e / 243084 MGIID:3513175 Length:423 Species:Mus musculus


Alignment Length:320 Identity:108/320 - (33%)
Similarity:154/320 - (48%) Gaps:55/320 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KYQALGAAHHQAKKLKIGDVNASSSDANKPVFRQNPIKNWFGAFNRNNSPAAQNQTSPTCSCRCG 120
            || |.|..:...:.:||..:|.:.||            |:|.                  .| ||
Mouse   146 KY-ATGPPNVDPESVKIKKINKTESD------------NYFN------------------HC-CG 178

  Fly   121 ERNDES------RIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGF----MW 175
            .|.::|      ||||||.....|:||.:.|.:.....||.||||:.:::|||||.:..    .|
Mouse   179 TRRNKSTVQTSVRIVGGTPVEEEEWPWQSSLRWDGSHRCGATLINNTWLVTAAHCFRTHKDPSRW 243

  Fly   176 FMIKVTFGEHDRCNDKERPETRFVLRAF-SQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRV 239
               ..|||    ...:.|..|..:.|.. .:|:.:.:.|.||||..|:..||.|:.:..:|||  
Mouse   244 ---SATFG----ATLQPRKLTTGIRRIIVHEKYKYPSHDYDIALAELSKPVPCTNAVHKVCLP-- 299

  Fly   240 EQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPG 304
            :...:...|.:...||:|.||.||.....|::|:|..:|...|....:| ...||..|:|:|:. 
Mouse   300 DANHEFQPGQRMFVTGFGALKNDGFTQNNLRQVQVDYIDTQTCNQPQSY-NGAITPRMLCAGFL- 362

  Fly   305 VGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENS 364
            .|.:|:||||||||||.....|..: ..|:||||:.|.:||.||||||||.:..||..|:
Mouse   363 KGEKDACQGDSGGPLVTADVRDIWY-LAGVVSWGDECGQPNKPGVYTRVTAFRHWIASNT 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 89/237 (38%)
Tryp_SPc 128..363 CDD:238113 90/239 (38%)
Tmprss11eNP_766468.1 SEA 50..145 CDD:279699
Tryp_SPc 191..417 CDD:214473 89/237 (38%)
Tryp_SPc 192..420 CDD:238113 90/239 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.