DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Tmprss11f

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_848845.1 Gene:Tmprss11f / 243083 MGIID:2442348 Length:439 Species:Mus musculus


Alignment Length:352 Identity:106/352 - (30%)
Similarity:156/352 - (44%) Gaps:77/352 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PATSTATSSLSSIPGKYQALGAAHHQAKKLKIGDVNASSSDANKPVFRQNPIKNWFGAFNRNNSP 105
            |:|.:|......|...:       :|:.|:|...:..|     .|.|...||          :|.
Mouse   135 PSTDSAERIKKRIERTF-------YQSLKIKQLPLTIS-----MPSFSLTPI----------DSK 177

  Fly   106 AAQNQTSPTCSCRCGERN-------DESRIVGGTTTGV-SEYPWMARLSYFNRFY-CGGTLINDR 161
            ..:|..:..|..|....|       ...|||.|..|.: .|:||.|.|......: ||.|||::.
Mouse   178 KMRNLLNSRCGIRMSSSNIPLPASSSTERIVQGRETAMEGEWPWQASLQLIGAGHQCGATLISNT 242

  Fly   162 YVLTAAHCVKGFMWFMIKVTFGEHDRCNDKERPETRFVLR-----------------AFSQKFSF 209
            ::||||||    .|               |.|..|::::.                 ...:::..
Mouse   243 WLLTAAHC----FW---------------KNRDPTKWIVTFGTTITPPLVKRSVGKIIIHEEYHR 288

  Fly   210 SNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEV 274
            ...:|||||.:|..||..::.::.:|||  :....|...|....||:|::.:||.....|::..|
Mouse   289 DTNENDIALAQLTTRVEFSNVVQRVCLP--DSSMKLPPKTSVFVTGFGSIVDDGPTQNKLRQARV 351

  Fly   275 PVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKR--FEQIGIVSW 337
            ..:.:|.|..:..| ..:||..|:|:|:. .|..|:|:||||||||.    |.|  :..:|||||
Mouse   352 ETIGSDVCNRKDVY-DGLITPGMLCAGFM-EGKIDACKGDSGGPLVY----DNRDIWYIVGIVSW 410

  Fly   338 GNGCARPNYPGVYTRVTKYLDWIVENS 364
            |..||.||.||||||||||.|||...:
Mouse   411 GQSCALPNKPGVYTRVTKYRDWIASKT 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 87/253 (34%)
Tryp_SPc 128..363 CDD:238113 88/255 (35%)
Tmprss11fNP_848845.1 SEA 60..164 CDD:396113 7/35 (20%)
Tryp_SPc 207..436 CDD:238113 88/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.