DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and TPSD1

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:216 Identity:75/216 - (34%)
Similarity:113/216 - (52%) Gaps:24/216 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 GERNDESRIVGGTTTGVSEYPWMARL----SYFNRFYCGGTLINDRYVLTAAHCVKGFMWFM--I 178
            |:...::.||||.....|::||...|    .|:..| |||:||:.::||||||||:..:..:  :
Human    30 GQALQQTGIVGGQEAPRSKWPWQVSLRVRGPYWMHF-CGGSLIHPQWVLTAAHCVEPDIKDLAAL 93

  Fly   179 KVTFGE-HDRCNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQR 242
            :|...| |....|:..|.:|.::.   .:|.......|||||.|.:.|.|:|.|..:.||...  
Human    94 RVQLREQHLYYQDQLLPVSRIIVH---PQFYIIQTGADIALLELEEPVNISSHIHTVTLPPAS-- 153

  Fly   243 QDLFVGTKAIATGWGTLKEDG--KPSCLLQEVEVPVLDNDECVAQ------TNYTQKMITKNMMC 299
            :....|.....||||.:..:.  .|...|:||||||::|..|.|:      |.::.:::..:|:|
Human   154 ETFPPGMPCWVTGWGDVDNNVHLPPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLC 218

  Fly   300 SGYPGVGGRDSCQGDSGGPLV 320
            :|..   ..||||||||||||
Human   219 AGSE---NHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 74/209 (35%)
Tryp_SPc 128..363 CDD:238113 74/208 (36%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 74/208 (36%)
Tryp_SPc 38..240 CDD:214473 74/208 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.