DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and F7

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_011535776.2 Gene:F7 / 2155 HGNCID:3544 Length:495 Species:Homo sapiens


Alignment Length:266 Identity:95/266 - (35%)
Similarity:133/266 - (50%) Gaps:23/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SPTCSCRCG------ERN---DESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAA 167
            :||....||      :||   .:.|||||......|.||...|.......|||||||..:|::||
Human   217 TPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKGECPWQVLLLVNGAQLCGGTLINTIWVVSAA 281

  Fly   168 HC---VKGFMWFMIKVTFGEHDRC-NDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPIT 228
            ||   :|.  |..:....||||.. :|.:....|.........:.....::|||||||:..|.:|
Human   282 HCFDKIKN--WRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTNHDIALLRLHQPVVLT 344

  Fly   229 SFIRPICLP-RVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYT--Q 290
            ..:.|:||| |....:.|.....::.:|||.|.:.|..:..|..:.||.|...:|:.|:...  .
Human   345 DHVVPLCLPERTFSERTLAFVRFSLVSGWGQLLDRGATALELMVLNVPRLMTQDCLQQSRKVGDS 409

  Fly   291 KMITKNMMCSGYPGVGGRDSCQGDSGGP-LVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVT 354
            ..||:.|.|:||.. |.:|||:|||||| ....|   ..:...||||||.|||...:.||||||:
Human   410 PNITEYMFCAGYSD-GSKDSCKGDSGGPHATHYR---GTWYLTGIVSWGQGCATVGHFGVYTRVS 470

  Fly   355 KYLDWI 360
            :|::|:
Human   471 QYIEWL 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 88/240 (37%)
Tryp_SPc 128..363 CDD:238113 88/241 (37%)
F7XP_011535776.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.