DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Tpsb2

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:263 Identity:96/263 - (36%)
Similarity:134/263 - (50%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 NDESRIVGGTTTGVSEYPWMA----RLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFG 183
            |....||||.....|::||..    :|:|:..| |||:||:.::||||||||            |
Mouse    27 NQRVGIVGGHEASESKWPWQVSLRFKLNYWIHF-CGGSLIHPQWVLTAAHCV------------G 78

  Fly   184 EHDRCNDKERPETR-FVLRAFSQKFSFSNF-----------DNDIALLRLNDRVPITSFIRPICL 236
            .|.:.....|.:.| ..|....|..|.:..           ..|:|||.|...|.:::.:.||.|
Mouse    79 PHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHPISL 143

  Fly   237 PRVEQRQDLFVGTKAIATGWGTLKEDG--KPSCLLQEVEVPVLDNDECVAQTN---YTQ---KMI 293
            |...  :....||....||||.:..|.  .|...|::|:||:::|..|..:.:   ||.   .::
Mouse   144 PPAS--ETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDFPIV 206

  Fly   294 TKNMMCSGYPGVGGRDSCQGDSGGPLV-RLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYL 357
            ...|:|:|..   .||||||||||||| :::   ..:.|.|:||||.|||:||.||:|||||.||
Mouse   207 HDGMLCAGNT---RRDSCQGDSGGPLVCKVK---GTWLQAGVVSWGEGCAQPNKPGIYTRVTYYL 265

  Fly   358 DWI 360
            |||
Mouse   266 DWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 93/257 (36%)
Tryp_SPc 128..363 CDD:238113 95/258 (37%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 95/258 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.