DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and Tmprss3

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:267 Identity:95/267 - (35%)
Similarity:136/267 - (50%) Gaps:35/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 CSCRCGERNDES-RIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCV-------- 170
            ||. ||.|...| |||||..:.::::||...|.:.....|||::|...:::||||||        
Mouse   226 CSA-CGTRTGYSPRIVGGNMSSLTQWPWQVSLQFQGYHLCGGSIITPLWIVTAAHCVYDLYHPKS 289

  Fly   171 ----KGFMWFMIKVTFGEHDRCNDKERPETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSFI 231
                .|.:..|            |...|........:..|:......|||||::|::.:.....|
Mouse   290 WTVQVGLVSLM------------DSPVPSHLVEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETI 342

  Fly   232 RPICLPRVEQR-QDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITK 295
            :|||||..|:. .|   |.....:|||..::.|..|.:|....||::.|..|..:..| ..:|:.
Mouse   343 QPICLPNSEENFPD---GKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVY-GGIISP 403

  Fly   296 NMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
            :|:|:||. .||.||||||||||||  ..:.:.::.:|..|:|.|||..|.||||||:|.:||||
Mouse   404 SMLCAGYL-KGGVDSCQGDSGGPLV--CQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWI 465

  Fly   361 VEN-SRD 366
            .|. .||
Mouse   466 HEQLERD 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 84/245 (34%)
Tryp_SPc 128..363 CDD:238113 85/247 (34%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133 4/7 (57%)
Tryp_SPc 238..465 CDD:214473 84/245 (34%)
Tryp_SPc 239..468 CDD:238113 85/247 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11120
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.