DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and F9

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:307 Identity:95/307 - (30%)
Similarity:161/307 - (52%) Gaps:28/307 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 HQAKKLKIGDVNASSSD---ANKPVFRQNPIKNWFGAFNRNNSPAAQNQTSPTCSCRCGERNDES 126
            :.:||:...:...|:.|   :.:.||.|:.|.:  ||...|.:.::::            .||.:
Mouse   185 YSSKKITRAETVFSNMDYENSTEAVFIQDDITD--GAILNNVTESSES------------LNDFT 235

  Fly   127 RIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCNDK 191
            |:|||......:.||...|:.....:|||.:||:::::|||||:|  ....|:|..||::....:
Mouse   236 RVVGGENAKPGQIPWQVILNGEIEAFCGGAIINEKWIVTAAHCLK--PGDKIEVVAGEYNIDKKE 298

  Fly   192 ERPETRFVLRAF---SQKFSFSNFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIA 253
            :..:.|.|:|..   ....:.:.:.:|||||.|:..:.:.|::.|||:...|.............
Mouse   299 DTEQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPICVANREYTNIFLKFGSGYV 363

  Fly   254 TGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGP 318
            :|||.:...|:.:.:||.:.||::|...|:..|.:|   |..||.|:|| ..||:|||:||||||
Mouse   364 SGWGKVFNKGRQASILQYLRVPLVDRATCLRSTTFT---IYNNMFCAGY-REGGKDSCEGDSGGP 424

  Fly   319 LVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWIVENSR 365
            .| ...:...| ..||:|||..||.....|:||:|::|::||.|.::
Mouse   425 HV-TEVEGTSF-LTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 79/235 (34%)
Tryp_SPc 128..363 CDD:238113 80/237 (34%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:291342
Tryp_SPc 236..464 CDD:214473 79/235 (34%)
Tryp_SPc 237..467 CDD:238113 80/237 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3752
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11114
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.