DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and F7

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_034302.2 Gene:F7 / 14068 MGIID:109325 Length:446 Species:Mus musculus


Alignment Length:286 Identity:97/286 - (33%)
Similarity:137/286 - (47%) Gaps:36/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 TSPTCSCR-------------------CG------ERNDES---RIVGGTTTGVSEYPWMARLSY 147
            |..||||.                   ||      :||..|   |||||......|.||.|.|..
Mouse   149 TKRTCSCHEDYTLQPDEVSCKPKVEYPCGRIPVVEKRNSSSRQGRIVGGNVCPKGECPWQAVLKI 213

  Fly   148 FNRFYCGGTLINDRYVLTAAHCVKGF-MWFMIKVTFGEHDRCNDKERPETRFVLRA-FSQKFSFS 210
            .....||..|::.|:::|||||.... .|..|.|..||||........:.|.|.:. ...|:...
Mouse   214 NGLLLCGAVLLDARWIVTAAHCFDNIRYWGNITVVMGEHDFSEKDGDEQVRRVTQVIMPDKYIRG 278

  Fly   211 NFDNDIALLRLNDRVPITSFIRPICLPRVEQRQDLFVGTK-AIATGWGTLKEDGKPSCLLQEVEV 274
            ..::|||||||:..|..|.::.|:|||.....::.....: :..:|||.|.:.|..:..|..:||
Mouse   279 KINHDIALLRLHRPVTFTDYVVPLCLPEKSFSENTLARIRFSRVSGWGQLLDRGATALELMSIEV 343

  Fly   275 PVLDNDECVAQTNYTQK--MITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSW 337
            |.|...:|:....::..  .||:||.|:||.. |.:|:|:||||||  ........:...|:|||
Mouse   344 PRLMTQDCLEHAKHSSNTPKITENMFCAGYMD-GTKDACKGDSGGP--HATHYHGTWYLTGVVSW 405

  Fly   338 GNGCARPNYPGVYTRVTKYLDWIVEN 363
            |.|||...:.||||||::|:||:|.:
Mouse   406 GEGCAAIGHIGVYTRVSQYIDWLVRH 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 85/237 (36%)
Tryp_SPc 128..363 CDD:238113 86/239 (36%)
F7NP_034302.2 GLA 24..85 CDD:214503
EGF_CA 87..123 CDD:238011
FXa_inhibition 132..168 CDD:291342 5/18 (28%)
Tryp_SPc 193..427 CDD:214473 84/236 (36%)
Tryp_SPc 194..431 CDD:238113 86/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3752
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11114
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.