DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and F10

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001229297.1 Gene:F10 / 14058 MGIID:103107 Length:493 Species:Mus musculus


Alignment Length:265 Identity:100/265 - (37%)
Similarity:141/265 - (53%) Gaps:36/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NQTSPTCSCRCGERNDES--RIVGGTTTGVSEYPWMARL-SYFNRFYCGGTLINDRYVLTAAHCV 170
            |:|.|       ||:.:.  |||||......|.||.|.| :..|..:||||::|:.|:||||||:
Mouse   230 NETQP-------ERSSDDLVRIVGGRECKDGECPWQALLINEDNEGFCGGTILNEFYILTAAHCL 287

  Fly   171 KGFMWFMIKVTFGEHDRCNDKER-----PETRFVLRAFSQKFSFSNFDNDIALLRLNDRVPITSF 230
            .....|.::|    .||..:||.     .|...|::  ..||....:|.|||:|||...:.....
Mouse   288 HQARRFKVRV----GDRNTEKEEGNEMVHEVDVVIK--HNKFQRDTYDYDIAVLRLKTPITFRMN 346

  Fly   231 IRPICLPRVEQRQDLFVGTK-AIATGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMIT 294
            :.|.|||:.:..:...:..| .|.:|:|...|.|:.|.:|:.:|||.:|.:.|...|:::   ||
Mouse   347 VAPACLPQKDWAESTLMTQKTGIVSGFGRTHEKGRQSNILKMLEVPYVDRNTCKLSTSFS---IT 408

  Fly   295 KNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQ----IGIVSWGNGCARPNYPGVYTRVTK 355
            :||.|:||. ....|:||||||||.|      .||:.    .||||||.||||....|:||:||.
Mouse   409 QNMFCAGYE-AKLEDACQGDSGGPHV------TRFKNTYYVTGIVSWGEGCARKGKYGIYTKVTT 466

  Fly   356 YLDWI 360
            :|.||
Mouse   467 FLKWI 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 93/243 (38%)
Tryp_SPc 128..363 CDD:238113 94/244 (39%)
F10NP_001229297.1 GLA 36..97 CDD:214503
EGF_CA 98..134 CDD:238011
FXa_inhibition 141..176 CDD:291342
Tryp_SPc 243..471 CDD:214473 93/243 (38%)
Tryp_SPc 244..473 CDD:238113 94/244 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 170 1.000 Domainoid score I3752
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11114
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.