DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and f7

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_571894.2 Gene:f7 / 114423 ZFINID:ZDB-GENE-010814-1 Length:433 Species:Danio rerio


Alignment Length:238 Identity:99/238 - (41%)
Similarity:136/238 - (57%) Gaps:10/238 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKGFMWFMIKVTFGEHDRCND 190
            ||||||:.......||...|.|..:.:|||.:....::||||||::......:::..||||...|
Zfish   194 SRIVGGSECPKGHCPWQVLLKYGEKGFCGGVIYKPTWILTAAHCLEKLKVKFLRIVAGEHDLEVD 258

  Fly   191 KERPETRFVLRAFSQ-KFSFSNFDNDIALLRLNDRVPITSFIRPICLP-RVEQRQDLFVGTKAIA 253
            :...:...|.:.|:. .:.....|:|||||||...:..:.:..|:||| |....::|:..:|...
Zfish   259 EGTEQLIQVDQMFTHPAYVSETADSDIALLRLRTPIVYSVYAVPVCLPLREMAERELWAVSKHTV 323

  Fly   254 TGWGTLKEDGKPSCLLQEVEVPVLDNDECVAQTNYTQKMITKNMMCSGYPGVGGR-DSCQGDSGG 317
            :|||...|||..|.||:.:.||.:...|||..:|.|   :|.||.|:||  :.|| |||:|||||
Zfish   324 SGWGKRSEDGPTSRLLRRLLVPRIRTQECVQVSNLT---LTSNMFCAGY--IEGRQDSCKGDSGG 383

  Fly   318 PLVRLRPDDKRFEQIGIVSWGNGCARPNYPGVYTRVTKYLDWI 360
            ||| .|..|..| .:||||||.|||||...|:||||:.||.||
Zfish   384 PLV-TRYRDTAF-LLGIVSWGKGCARPGSYGIYTRVSNYLQWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 96/235 (41%)
Tryp_SPc 128..363 CDD:238113 97/236 (41%)
f7NP_571894.2 GLA 19..82 CDD:214503
EGF_CA 86..121 CDD:238011
FXa_inhibition 131..166 CDD:291342
Tryp_SPc 195..424 CDD:214473 96/235 (41%)
Tryp_SPc 196..427 CDD:238113 97/236 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.