DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and PRSS21

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:282 Identity:100/282 - (35%)
Similarity:145/282 - (51%) Gaps:51/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 QNQTSPTCSCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHCVKG 172
            ::|.:...|..||.|...||||||....:..:||...|..::...||.:|::.|:.||||||.:.
Human    22 ESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFET 86

  Fly   173 FM-------WFMIKVTFGEHDRCNDKERPETRFVLRAFSQKFSFSNF----------DNDIALLR 220
            :.       |.   |.||:      .....:.:.|:|:..::..||.          ..||||::
Human    87 YSDLSDPSGWM---VQFGQ------LTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVK 142

  Fly   221 LNDRVPITSFIRPICLP----RVEQRQDLFVGTKAIATGWGTLKED-GKPS-CLLQEVEVPVLDN 279
            |:..|..|..|:||||.    ..|.|.|.:|      ||||.:||| ..|| ..||||:|.:::|
Human   143 LSAPVTYTKHIQPICLQASTFEFENRTDCWV------TGWGYIKEDEALPSPHTLQEVQVAIINN 201

  Fly   280 DECVAQTNYT------QKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWG 338
            ..|    |:.      :|.|..:|:|:| ...||:|:|.|||||||...:  :..:.|||:||||
Human   202 SMC----NHLFLKYSFRKDIFGDMVCAG-NAQGGKDACFGDSGGPLACNK--NGLWYQIGVVSWG 259

  Fly   339 NGCARPNYPGVYTRVTKYLDWI 360
            .||.|||.|||||.::.:.:||
Human   260 VGCGRPNRPGVYTNISHHFEWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 92/261 (35%)
Tryp_SPc 128..363 CDD:238113 93/262 (35%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 93/262 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.