DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and prss56

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:272 Identity:107/272 - (39%)
Similarity:145/272 - (53%) Gaps:27/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 NNSPAAQNQTSPTCSCRCGER--------NDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLI 158
            |.||   :..||.   .||::        ..:.|||||:.|....:||:..:.:.....|||.|:
 Frog    47 NTSP---DDGSPV---TCGQKFSSISNNTGPKGRIVGGSITSPGSWPWLVNIRFNGELMCGGVLL 105

  Fly   159 NDRYVLTAAHCVKG----FMWFMIKVTFGEHDRCNDKERPETRFVLRAFSQ-KFSFSNFDNDIAL 218
            :|.::||||||..|    .:|   .|..|::|...:.:..:|..|.|..:. ||:...||||:||
 Frog   106 DDMWILTAAHCFTGSVNEVLW---TVVVGQYDLTKNAQGEKTFQVNRIVTHPKFNQKTFDNDLAL 167

  Fly   219 LRLNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDECV 283
            |.|...|..:...||:|||.|.  :|...||.....|||:|.|||..|.::.|..||||..:.| 
 Frog   168 LELTSSVTASQSARPVCLPPVP--RDPTPGTNCYIAGWGSLYEDGPLSDVIMEARVPVLSQEAC- 229

  Fly   284 AQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYPG 348
             ::...:.|:|..|.|:||.. ||.|||||||||||....|..|::...||.|||:||.....||
 Frog   230 -RSTLGKNMLTSTMFCAGYLN-GGIDSCQGDSGGPLTCQDPISKQYVLYGITSWGDGCGERGKPG 292

  Fly   349 VYTRVTKYLDWI 360
            ||||||.:.|||
 Frog   293 VYTRVTAFTDWI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 98/237 (41%)
Tryp_SPc 128..363 CDD:238113 99/238 (42%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 99/238 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H79885
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9508
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.