DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and tmprss2.14

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_031752402.1 Gene:tmprss2.14 / 101731505 XenbaseID:XB-GENE-22065937 Length:504 Species:Xenopus tropicalis


Alignment Length:273 Identity:94/273 - (34%)
Similarity:132/273 - (48%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 AAQNQTSPTC-SCRCGERNDESRIVGGTTTGVSEYPWMARLSYFNR-----FYCGGTLINDRYVL 164
            |:.|..|..| ||....:.| |||||||.....::||..:|  ..|     :.|||::|...:|:
 Frog   243 ASGNMVSLRCISCGLSTKVD-SRIVGGTVASAGDWPWQVQL--LKRVGASLYLCGGSIITQHWVV 304

  Fly   165 TAAHCVKG-------FMWFMIKVTFGEHDRCN-DKERPETRFVLRAFSQKFSFSNFDNDIALLRL 221
            ||||||.|       |..|...:|...:.... ..||........:::|.:       |:|||:|
 Frog   305 TAAHCVYGSTSTPSAFKVFAGSLTIQSYYSAGYTVERALVHPSYSSYTQNY-------DVALLKL 362

  Fly   222 NDRVPITSFIRPICLPRV----EQRQDLFVGTKAIATGWGTLKEDGKPSCLLQEVEVPVLDNDEC 282
            ...:..|:.:||:|||.|    .:.|..::      :||||....|..|..|:...||::.:..|
 Frog   363 TAALVFTTNLRPVCLPNVGMPWAEGQPCWI------SGWGTTSNGGSISTNLKAASVPLISSATC 421

  Fly   283 VAQTNYTQKMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFEQIGIVSWGNGCARPNYP 347
            .....| ...|:..|||:||.. ||.|:||||||||||  ...:..:..:|..|||.||...|.|
 Frog   422 NQAAVY-GGAISPTMMCAGYLS-GGTDTCQGDSGGPLV--TKTNSLWWLVGDTSWGYGCGMTNKP 482

  Fly   348 GVYTRVTKYLDWI 360
            |||..:|..|:||
 Frog   483 GVYGNLTFSLEWI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 84/249 (34%)
Tryp_SPc 128..363 CDD:238113 85/250 (34%)
tmprss2.14XP_031752402.1 LDLa <96..121 CDD:238060
LDLa 128..159 CDD:238060
SRCR_2 164..259 CDD:406055 6/15 (40%)
Tryp_SPc 265..497 CDD:238113 85/250 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.