DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4914 and zgc:165423

DIOPT Version :9

Sequence 1:NP_648711.1 Gene:CG4914 / 39597 FlyBaseID:FBgn0036436 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:284 Identity:106/284 - (37%)
Similarity:146/284 - (51%) Gaps:56/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SPTCSCR-------CGERNDESRIVGGTTTGVSEYPWMARLSYFNRFYCGGTLINDRYVLTAAHC 169
            |..|.|:       ||:....::|||||......:||.|.|......:|||:||:|:::|:||||
Zfish    15 STGCDCQPTQSPPACGKAPLNTKIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHC 79

  Fly   170 VKGFMWFMIKVTFGEHDRCND---------KERPETRFVLRAFSQ-----KFSFSNFDNDIALLR 220
                        |..:...:|         ::.|....|.::.||     .:..|..|||:|||.
Zfish    80 ------------FPSNPNPSDYTVYLGRQSQDLPNPNEVSKSVSQVIVHPLYQGSTHDNDMALLH 132

  Fly   221 LNDRVPITSFIRPICLPRVEQRQDLFVGTKAIATGWGTLKEDG--KPS-CLLQEVEVPVLDNDEC 282
            |:..|..:::|:|:||   ......|.......|||||: |.|  .|| .:||||.||::.|:.|
Zfish   133 LSSPVTFSNYIQPVCL---AADGSTFYNDTMWITGWGTI-ESGVSLPSPQILQEVNVPIVGNNLC 193

  Fly   283 VAQTNYTQ---KMITKNMMCSGYPGVGGRDSCQGDSGGPLVRLRPDDKRFE---QIGIVSWGNGC 341
                |...   ..||.||||:|.. .||:||||||||||:|     .|.|.   |.|:||:|.||
Zfish   194 ----NCLYGGGSSITNNMMCAGLM-QGGKDSCQGDSGGPMV-----IKSFNTWVQAGVVSFGKGC 248

  Fly   342 ARPNYPGVYTRVTKYLDWIVENSR 365
            |.|||||||.||::|.:||.:..|
Zfish   249 ADPNYPGVYARVSQYQNWISQYVR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4914NP_648711.1 Tryp_SPc 127..360 CDD:214473 98/255 (38%)
Tryp_SPc 128..363 CDD:238113 100/257 (39%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 98/255 (38%)
Tryp_SPc 38..269 CDD:238113 100/256 (39%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.